Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0101, Human (His)

The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH) . KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIAA0101 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kiaa0101-protein-human-his.html

Purity

98.0

Smiles

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Molecular Formula

9768 (Gene_ID) Q15004-1 (M1-E111) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1orf156 (METTL18) activation kit by CRISPRa
GA114207 1 Kit

Human C1orf156 (METTL18) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS627093 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Human ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit
E-CL-H0268-01 24 Tests

Human ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit

Sign In for Pricing
View Details
Human ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit
E-CL-H0268-02 48 Tests

Human ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit

Sign In for Pricing
View Details
Human ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit
E-CL-H0268-03 96 Tests

Human ANGPTL2 (Angiopoietin Like Protein 2) CLIA Kit

Sign In for Pricing
View Details
N6AMT2 (EEF1AKMT1) (NM_174928) Human Recombinant Protein
TP305604L 1 mg

N6AMT2 (EEF1AKMT1) (NM_174928) Human Recombinant Protein

Sign In for Pricing
View Details