Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0101, Human (His)

The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH) . KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

KIAA0101 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kiaa0101-protein-human-his.html

Purity

98.0

Smiles

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Molecular Formula

9768 (Gene_ID) Q15004-1 (M1-E111) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2’-Deoxy-beta-L-adenosine (May contain up to 20% inorganics)
TRC-D231628-25MG 25 mg

2’-Deoxy-beta-L-adenosine (May contain up to 20% inorganics)

Sign In for Pricing
View Details
HOXD8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]
TA810941BM 100 µL

HOXD8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF568 conjugate, 0.1mg/mL
BNC680843-500 1x 500 µL

CD106 / VCAM1 (VCAM1/843), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS505556 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
IRF2BP1 Mouse Monoclonal Antibody [Clone ID: OTI3F4]
CF811706 100 µg

IRF2BP1 Mouse Monoclonal Antibody [Clone ID: OTI3F4]

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP565472 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details