Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Staphylococcal enterotoxin E
AG122 1 mg

Staphylococcal enterotoxin E

Sign In for Pricing
View Details
Mouse Monoclonal Ribonuclease Inhibitor Antibody (1H23) [Alexa Fluor 750]
NBP1-30167AF750 0.1 mL

Mouse Monoclonal Ribonuclease Inhibitor Antibody (1H23) [Alexa Fluor 750]

Sign In for Pricing
View Details
3-Chloro-5-nitro-2-pyridinethiol
sc-310819 1 mg

3-Chloro-5-nitro-2-pyridinethiol

Sign In for Pricing
View Details
Human TRIM29 shRNA Plasmid
abx958424-01 150 µg

Human TRIM29 shRNA Plasmid

Sign In for Pricing
View Details
Human TRIM29 shRNA Plasmid
abx958424-02 300 µg

Human TRIM29 shRNA Plasmid

Sign In for Pricing
View Details
Human SH2D2A knockdown cell line
ABC-KD13707 1 Vial

Human SH2D2A knockdown cell line

Sign In for Pricing
View Details