Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsku (NM_001009965) Rat Tagged ORF Clone Lentiviral Particle
RR209057L3V 200 µL

Tsku (NM_001009965) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hist1h2ae 3'UTR GFP Stable Cell Line
TU159530 1.0 mL

Hist1h2ae 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RGD1563015 Rat shRNA Plasmid (Locus ID 500537)
TL708766 1 Kit

RGD1563015 Rat shRNA Plasmid (Locus ID 500537)

Sign In for Pricing
View Details
PNCAPD3-Fluc-Enhancer Plasmid
PVT71238 2 µg

PNCAPD3-Fluc-Enhancer Plasmid

Sign In for Pricing
View Details
INADL Protein Vector (Mouse) (pPM-C-HA)
PV191732 500 ng

INADL Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Vmn1r131 (NM_001166839) AAV Particle
MR221353A1V 250 µL

Mouse Vmn1r131 (NM_001166839) AAV Particle

Sign In for Pricing
View Details