Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1B1 (V-type Proton ATPase Subunit B, Kidney Isoform, V-ATPase Subunit B 1, Endomembrane Proton Pump 58kD Subunit, Vacuolar Proton Pump Subunit B 1, ATP6B1, VATB, VPP3) (MaxLight 750) discontinued
123722-ML750 100 µL

ATP6V1B1 (V-type Proton ATPase Subunit B, Kidney Isoform, V-ATPase Subunit B 1, Endomembrane Proton Pump 58kD Subunit, Vacuolar Proton Pump Subunit B 1, ATP6B1, VATB, VPP3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Acutilol A
TBZ30061 unit

Acutilol A

Sign In for Pricing
View Details
Claudin 3, 4, 6, 9 Rabbit pAb
E47R2816 100 µL

Claudin 3, 4, 6, 9 Rabbit pAb

Sign In for Pricing
View Details
Tsc2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
48544114 3x 1.0 µg

Tsc2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SOX8, ID (SOX8, Transcription factor SOX-8) (FITC) discontinued
042177-FITC 200 µL

SOX8, ID (SOX8, Transcription factor SOX-8) (FITC) discontinued

Sign In for Pricing
View Details
POF1B (FITC)
572768-01 50 µg

POF1B (FITC)

Sign In for Pricing
View Details