Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Human (HEK293, hFc)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. AGER Protein, Human (HEK293, hFc) is the recombinant human-derived AGER protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

AGER Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-human-hek293-hfc.html

Purity

91.73

Smiles

QNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Formula

177 (Gene_ID) Q15109 (Q24-A344) (Accession)

Molecular Weight

Approximately 76.18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP8AP2 (CASP8-associated Protein 2, FLICE-associated Huge Protein, FLASH, KIAA1315, RIP25) (MaxLight 750) discontinued
029434-ML750 100 µL

CASP8AP2 (CASP8-associated Protein 2, FLICE-associated Huge Protein, FLASH, KIAA1315, RIP25) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Selv 3'UTR GFP Stable Cell Line
TU270094 1.0 mL

Selv 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Slit1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11487R-BF594 100 µL

Slit1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Phospho-TrkB (Tyr515) Polyclonal Antibody, Cy3 Conjugated
bs-5525R-Cy3 100 µL

Phospho-TrkB (Tyr515) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (HRP) discontinued
143599-HRP 100 µL

Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (HRP) discontinued

Sign In for Pricing
View Details
TAPI-1
T6009 1 mg

TAPI-1

Sign In for Pricing
View Details