Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Alpha-synuclein (SNCA)

Product Specifications

Product Name Alternative

SNCA; Alpha-synuclein

Abbreviation

Recombinant Pig SNCA protein

Gene Name

SNCA

UniProt

Q3I5G7

Expression Region

1-140aa

Organism

Sus scrofa (Pig)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

May be involved in the regulation of dopamine release and transport.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.0 kDa

References & Citations

"P25alpha / TPPP expression increases plasma membrane presentation of the dopamine transporter and enhances cellular sensitivity to dopamine toxicity." Fjorback A.W., Sundbye S., Dachsel J.C., Sinning S., Wiborg O., Jensen P.H. FEBS J. 278:493-505 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOBEC3G (NM_021822) Human Over-expression Lysate
LS060489 100 µg

APOBEC3G (NM_021822) Human Over-expression Lysate

Sign In for Pricing
View Details
CLMN Protein Vector (Mouse) (pPM-C-HA)
PV166328 500 ng

CLMN Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Ac-Orn-Phe-Arg-AMC acetate
orb3180496-01 50 mg

Ac-Orn-Phe-Arg-AMC acetate

Sign In for Pricing
View Details
Ac-Orn-Phe-Arg-AMC acetate
orb3180496-02 10 mg

Ac-Orn-Phe-Arg-AMC acetate

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable ubiquinone biosynthesis protein UbiB (ubiB)
orb2923699-01 20 µg

Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable ubiquinone biosynthesis protein UbiB (ubiB)
orb2923699-02 100 µg

Recombinant Actinobacillus pleuropneumoniae serotype 5b Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details