Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-gamma/CXCL3, Human (His)

CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. GRO-gamma/CXCL3 Protein, Human (His) is produced in E. coli with six N-Terminal His-tags. It consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-gamma/CXCL3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-gama-cxcl3-protein-human-his.html

Purity

98.0

Smiles

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Molecular Formula

2921 (Gene_ID) P19876 (A35-N107) (Accession)

Molecular Weight

Approximately 9-13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Niradiz Reyes, et al. CXCL3 Signaling in the Tumor Microenvironment. Adv Exp Med Biol. 2021;1302:15-24.|[2]Joji Kusuyama, et al. CXCL3 positively regulates adipogenic differentiation. J Lipid Res. 2016 Oct;57 (10) :1806-1820.|[3]Khushboo Gulati, et al. Molecular cloning and biophysical characterization of CXCL3 chemokine. Int J Biol Macromol. 2018 Feb;107 (Pt A) :575-584.|[4]Jinru Weng, et al. CXCL3 overexpression affects the malignant behavior of oral squamous cell carcinoma cells via the MAPK signaling pathway. J Oral Pathol Med. 2021 Oct;50 (9) :902-910.|[5]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[6]Jian Guan, et al. Clinical significance and biological functions of chemokine CXCL3 in head and neck squamous cell carcinoma. Biosci Rep. 2021 Dec 22;41 (12) :BSR20212403.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF488A conjugate, 0.1mg/mL
BNC880901-100 1x 100 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details