Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 NSP8 (His)

The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. The ORF1ab protein is associated with viral replication and transcription, inhibition of host translation machinery, and suppression of host immune responses. SARS-CoV-2 NSP8 Protein (His) is the recombinant Virus-derived SARS-CoV-2 NSP8 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SARS-CoV-2 NSP8 Protein (His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-nsp8-protein-his.html

Purity

94.40

Smiles

AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ

Molecular Formula

43740578 (Gene_ID) YP_009725304.1 (A1-Q198) (Accession)

Molecular Weight

Approximately 23.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-3-iodo-L-tyrosine Amide
TRC-A179410-250MG 250 mg

N-Acetyl-3-iodo-L-tyrosine Amide

Sign In for Pricing
View Details
Carboxylated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB04F2-COOH 10x 96 Well Plates

Carboxylated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details
Cxx1c (BC031701) Mouse Tagged ORF Clone
MG200438 10 µg

Cxx1c (BC031701) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD154 Antibody[24-31]
AN003410-01 100 µg

AF/LE Purified Anti-Human CD154 Antibody[24-31]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD154 Antibody[24-31]
AN003410-02 1 mg

AF/LE Purified Anti-Human CD154 Antibody[24-31]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD154 Antibody[24-31]
AN003410-03 5 mg

AF/LE Purified Anti-Human CD154 Antibody[24-31]

Sign In for Pricing
View Details