Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 NSP8 (His)

The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. The ORF1ab protein is associated with viral replication and transcription, inhibition of host translation machinery, and suppression of host immune responses. SARS-CoV-2 NSP8 Protein (His) is the recombinant Virus-derived SARS-CoV-2 NSP8 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SARS-CoV-2 NSP8 Protein (His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-nsp8-protein-his.html

Purity

94.40

Smiles

AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ

Molecular Formula

43740578 (Gene_ID) YP_009725304.1 (A1-Q198) (Accession)

Molecular Weight

Approximately 23.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (1415-1), CF640R conjugate, 0.1mg/mL
BNC400580-500 1x 500 µL

Histone H1 (1415-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Response Factor (SRF) Rabbit Polyclonal Antibody
TA392896 100 µL

Serum Response Factor (SRF) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zfp688 Mouse Gene Knockout Kit (CRISPR)
KN519939 1 Kit

Zfp688 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ALDH1A3 Antibody
OC-696-01 50 μL

ALDH1A3 Antibody

Sign In for Pricing
View Details
ALDH1A3 Antibody
OC-696-02 100 µL

ALDH1A3 Antibody

Sign In for Pricing
View Details
ALDH1A3 Antibody
OC-696-03 1 mL

ALDH1A3 Antibody

Sign In for Pricing
View Details