Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 NSP8 (His)

The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. The ORF1ab protein is associated with viral replication and transcription, inhibition of host translation machinery, and suppression of host immune responses. SARS-CoV-2 NSP8 Protein (His) is the recombinant Virus-derived SARS-CoV-2 NSP8 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SARS-CoV-2 NSP8 Protein (His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-nsp8-protein-his.html

Purity

94.40

Smiles

AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ

Molecular Formula

43740578 (Gene_ID) YP_009725304.1 (A1-Q198) (Accession)

Molecular Weight

Approximately 23.7 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBLL1 Rabbit Polyclonal Antibody
TA333662 100 µL

CBLL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rtn-3 Double Nickase Plasmid (h)
sc-404072-NIC 20 µg

Rtn-3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
ZNF28 (Zinc Finger Protein 28, DKFZp781D0275, KOX24)
253725 100 µg

ZNF28 (Zinc Finger Protein 28, DKFZp781D0275, KOX24)

Sign In for Pricing
View Details
Human ANXA9 protein
orb244016-01 20 µg

Human ANXA9 protein

Sign In for Pricing
View Details
Human ANXA9 protein
orb244016-02 100 µg

Human ANXA9 protein

Sign In for Pricing
View Details
Human ANXA9 protein
orb244016-03 1 mg

Human ANXA9 protein

Sign In for Pricing
View Details