Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deoxyribonuclease gamma (DNASE1L3)

Product Specifications

CAS Number

9000-83-3

Gene Name

DNASE1L3

UniProt

Q13609

Expression Region

21-305aa

Organism

Homo sapiens

Target Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Tag

C-terminal 6xHis-tagged

Source

E.coli

Field of Research

Cell Biology

Assay Type

Developed Protein

Relevance

Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends. Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA. Acts in internucleosomal DNA fragmentation (INDF) during apoptosis and necrosis. The role in apoptosis includes myogenic and neuronal differentiation, and BCR-mediated clonal deletion of self-reactive B cells. Is active on chromatin in apoptotic cell-derived membrane-coated microparticles and thus suppresses anti-DNA autoimmunity. Together with DNASE1, plays a key role in degrading neutrophil extracellular traps (NETs). NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation. Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse LTF/LF (Lactoferrin) ELISA Kit
EM10518 96 Tests

Mouse LTF/LF (Lactoferrin) ELISA Kit

Sign In for Pricing
View Details
1700028P14Rik (NM_026188) Mouse Tagged ORF Clone Lentiviral Particle
MR202719L4V 200 µL

1700028P14Rik (NM_026188) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MGC114483 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV643107 1.0 µg DNA

MGC114483 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Egfl7 (NM_178444) AAV Particle
MR217281A1V 250 µL

Mouse Egfl7 (NM_178444) AAV Particle

Sign In for Pricing
View Details
Recombinant YFV DEFB Protein (aa 59-98)
VAng-Cr6544-500gEcoli 500 µg (E. coli)

Recombinant YFV DEFB Protein (aa 59-98)

Sign In for Pricing
View Details
Human Endothelin 1 (EDN1) CLIA Kit
MBS2000884-01 24 Strip Well

Human Endothelin 1 (EDN1) CLIA Kit

Sign In for Pricing
View Details