Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABARAP, Human (GST)

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA (A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (GST) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

GABARAP Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gabarap-protein-human-gst.html

Smiles

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Molecular Formula

11337 (Gene_ID) Q6IAW1 (M1-L117) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VIRMA Human Gene Knockout Kit (CRISPR)
KN422516 1 Kit

VIRMA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Fluorophenyl-5’-oxobutyric Acid
TRC-F588495-50MG 50 mg

4-Fluorophenyl-5’-oxobutyric Acid

Sign In for Pricing
View Details
PSMA (FOLH1) (NM_004476) Human Recombinant Protein
TP318310M 100 µg

PSMA (FOLH1) (NM_004476) Human Recombinant Protein

Sign In for Pricing
View Details
Polystyrene Low Loaded Sieber Resin
HLL10024.50G 50 g

Polystyrene Low Loaded Sieber Resin

Sign In for Pricing
View Details
ITS3-ITS4 Library Preparation Kit for Illumina (Set A)
71110 96 Preparations

ITS3-ITS4 Library Preparation Kit for Illumina (Set A)

Sign In for Pricing
View Details
bcl 6 (BCL6) (NM_001130845) Human Over-expression Lysate
LY427282 100 µg

bcl 6 (BCL6) (NM_001130845) Human Over-expression Lysate

Sign In for Pricing
View Details