Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABARAP, Human (GST)

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA (A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (GST) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

GABARAP Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gabarap-protein-human-gst.html

Smiles

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Molecular Formula

11337 (Gene_ID) Q6IAW1 (M1-L117) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF810492 100 µg

AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI2D11]

Sign In for Pricing
View Details
5-dR110 [5-Carboxy-4,7-dichlororhodamine 110]
315-AAT 25 mg

5-dR110 [5-Carboxy-4,7-dichlororhodamine 110]

Sign In for Pricing
View Details
Hey L (HEYL) Human Gene Knockout Kit (CRISPR)
KN402851 1 Kit

Hey L (HEYL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SH3BP1 Human Gene Knockout Kit (CRISPR)
KN419860 1 Kit

SH3BP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WNT3 (NM_030753) Human Over-expression Lysate
LY403082 100 µg

WNT3 (NM_030753) Human Over-expression Lysate

Sign In for Pricing
View Details
SERPING1 (NM_000062) Human Over-expression Lysate
LC400023 20 µg

SERPING1 (NM_000062) Human Over-expression Lysate

Sign In for Pricing
View Details