NPPB, Human (His)
NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
NPPB Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nppb-protein-human-108a-a-n-his.html
Purity
95.0
Smiles
HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Molecular Formula
4879 (Gene_ID) P16860 (H27-H134) (Accession)
Molecular Weight
Approximately 15 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Lentiviral mouse Mppe1 shRNA (UAS) - Lentiviral mouse Mppe1 shRNA (UAS, GFP) plasmid
HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para
HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para