Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Blood group Rh (D) polypeptide (RHD), partial

Product Specifications

Product Name Alternative

RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240D

Abbreviation

Recombinant Human RHD protein, partial

Gene Name

RHD

UniProt

Q02161

Expression Region

388-417aa

Organism

Homo sapiens (Human)

Target Sequence

LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.

Molecular Weight

33.6 kDa

References & Citations

"Rh (D) antigen expression and isolation of a new Rh (D) cDNA isoform in human erythroleukemic K562 cells." Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACS1 Human Gene Knockout Kit (CRISPR)
KN204036RB 1 Kit

PACS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Scoc Mouse Gene Knockout Kit (CRISPR)
KN515397 1 Kit

Scoc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human BBOX1/Gamma-BBH Protein (His & GST Tag)
PKSH030526 100 µg

Recombinant Human BBOX1/Gamma-BBH Protein (His & GST Tag)

Sign In for Pricing
View Details
Protein G Colloidal Gold, 1mL 40nm
GP-02-40 1 mL

Protein G Colloidal Gold, 1mL 40nm

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS705185 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Tex45 Mouse Gene Knockout Kit (CRISPR)
KN500102 1 Kit

Tex45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details