Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Human (sf9, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human (sf9, His) is the recombinant human-derived SCF protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-human-sf9-his.html

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human T-Lymphotropic VirusI /II (HTLV-I/II) ELISA Kit
MBS3802272-01 48 Well

Human T-Lymphotropic VirusI /II (HTLV-I/II) ELISA Kit

Ask
View Details
Human T-Lymphotropic VirusI /II (HTLV-I/II) ELISA Kit
MBS3802272-02 96 Well

Human T-Lymphotropic VirusI /II (HTLV-I/II) ELISA Kit

Ask
View Details
Human T-Lymphotropic VirusI /II (HTLV-I/II) ELISA Kit
MBS3802272-03 5x 96 Well

Human T-Lymphotropic VirusI /II (HTLV-I/II) ELISA Kit

Ask
View Details
Human T-Lymphotropic VirusI /II (HTLV-I/II) ELISA Kit
MBS3802272-04 10x 96 Well

Human T-Lymphotropic VirusI /II (HTLV-I/II) ELISA Kit

Ask
View Details
CBFA2T2 Peptide
MBS3229114-01 0.1 mg

CBFA2T2 Peptide

Ask
View Details
CBFA2T2 Peptide
MBS3229114-02 5x 0.1 mg

CBFA2T2 Peptide

Ask
View Details