Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Human (sf9, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human (sf9, His) is the recombinant human-derived SCF protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

SCF Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-human-sf9-his.html

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT6 (Nucleoside Diphosphate-linked Moiety X Motif 6, Nudix Motif 6, Antisense Basic Fibroblast Growth Factor, ASFGF2, FGF2AS, FGF-AS, gfg, gfg-1, Protein GFG) (MaxLight 405) discontinued
130640-ML405 100 µL

NUDT6 (Nucleoside Diphosphate-linked Moiety X Motif 6, Nudix Motif 6, Antisense Basic Fibroblast Growth Factor, ASFGF2, FGF2AS, FGF-AS, gfg, gfg-1, Protein GFG) (MaxLight 405) discontinued

Sign In for Pricing
View Details
TAZ, NT (Protein G4.5, Tafazzin, EFE2, G4.5)
MBS6013176-01 0.2 mL

TAZ, NT (Protein G4.5, Tafazzin, EFE2, G4.5)

Sign In for Pricing
View Details
TAZ, NT (Protein G4.5, Tafazzin, EFE2, G4.5)
MBS6013176-02 5x 0.2 mL

TAZ, NT (Protein G4.5, Tafazzin, EFE2, G4.5)

Sign In for Pricing
View Details
2-Chloro-N-[1- (4-ethylphenyl) ethyl]propanamide
DWB02240-01 50 mg

2-Chloro-N-[1- (4-ethylphenyl) ethyl]propanamide

Sign In for Pricing
View Details
2-Chloro-N-[1- (4-ethylphenyl) ethyl]propanamide
DWB02240-02 0.5 g

2-Chloro-N-[1- (4-ethylphenyl) ethyl]propanamide

Sign In for Pricing
View Details
Recombinant Human P2RY2 VLP
WHM-Q029 100 µg, 1 mg

Recombinant Human P2RY2 VLP

Sign In for Pricing
View Details