UGRP1, Human
UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
UGRP1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ugrp1-protein-human.html
Purity
95.0
Smiles
FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
Molecular Formula
117156 (Gene_ID) Q96PL1 (F22-V93) (Accession)
Molecular Weight
Approximately 6&7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Lentiviral human CEP83 sgRNA gene knockout kit - Lentiviral human CEP83 sgRNA gene knockout kit (plasmid)
Recombinant Arabidopsis thaliana Translocon-associated protein subunit alpha (At2g21160), partial
Crystallin, alpha A (alpha A Crystallin Protein, Alpha Crystallin A Chain, CRYAA, Acry-1, Crystallin Alpha 1, CRYA1, Heat Shock Protein beta 4, HSPB4) (Biotin) discontinued
Rabbit Polyclonal XRCC1 Antibody [Allophycocyanin]