Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGRP1, Human

UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UGRP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ugrp1-protein-human.html

Purity

95.0

Smiles

FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Molecular Formula

117156 (Gene_ID) Q96PL1 (F22-V93) (Accession)

Molecular Weight

Approximately 6&7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ATPase family AAA domain-containing protein 1 (ATAD1) Rat ELISA Kit
B7462 96 Tests

ATPase family AAA domain-containing protein 1 (ATAD1) Rat ELISA Kit

Ask
View Details
(2S) -1-[ (2S) -2-[[ (2S) -1-[ (2S) -2-[[ (2S) -2-[[ (2S) -2-amino-3-phenylpropanoyl]amino]-3-methylbutanoyl]amino]propanoyl]pyrrolidine-2-carbonyl]amino]-3-phenylpropanoyl]pyrrolidine-2-carboxylic acid
JH641241 1 Each

(2S) -1-[ (2S) -2-[[ (2S) -1-[ (2S) -2-[[ (2S) -2-[[ (2S) -2-amino-3-phenylpropanoyl]amino]-3-methylbutanoyl]amino]propanoyl]pyrrolidine-2-carbonyl]amino]-3-phenylpropanoyl]pyrrolidine-2-carboxylic acid

Ask
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Bovine IgG Antibody
AAF-411-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Bovine IgG Antibody

Ask
View Details
Chicken Polyclonal Chicken anti-Goat IgG Secondary Antibody
NB710-58357 1 mL

Chicken Polyclonal Chicken anti-Goat IgG Secondary Antibody

Ask
View Details