Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGRP1, Human

UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UGRP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ugrp1-protein-human.html

Purity

95.0

Smiles

FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Molecular Formula

117156 (Gene_ID) Q96PL1 (F22-V93) (Accession)

Molecular Weight

Approximately 6&7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLKO.1-TPM2 shRNA-1 Plasmid
PVTB00734-3a 2 µg

pLKO.1-TPM2 shRNA-1 Plasmid

Sign In for Pricing
View Details
Rat CD161 MAb (Clone 10/78)
MAB9766-SP 25 µg

Rat CD161 MAb (Clone 10/78)

Sign In for Pricing
View Details
Mouse CD309/KDR/VEGFR-2 Recombinant Protein (N-His)
MW338012-01 50 µg

Mouse CD309/KDR/VEGFR-2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Mouse CD309/KDR/VEGFR-2 Recombinant Protein (N-His)
MW338012-02 100 µg

Mouse CD309/KDR/VEGFR-2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Mouse CD309/KDR/VEGFR-2 Recombinant Protein (N-His)
MW338012-03 1 mg

Mouse CD309/KDR/VEGFR-2 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human TRA-1-81 Alexa Fluor 405 Antibody (Clone TRA-1-81)
FAB8495V-100UG 100 µg

Human TRA-1-81 Alexa Fluor 405 Antibody (Clone TRA-1-81)

Sign In for Pricing
View Details