Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGRP1, Human

UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UGRP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ugrp1-protein-human.html

Purity

95.0

Smiles

FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Molecular Formula

117156 (Gene_ID) Q96PL1 (F22-V93) (Accession)

Molecular Weight

Approximately 6&7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm11756 Protein Vector (Mouse) (pPM-C-HA)
PV182756 500 ng

Gm11756 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Evista (Raloxifene HCl) 500mg
A10375-500 500 mg

Evista (Raloxifene HCl) 500mg

Sign In for Pricing
View Details
RPL24 Antibody
E19-9128-1 50 µg - 50 µL

RPL24 Antibody

Sign In for Pricing
View Details
Recombinant Glutamyl Prolyl tRNA Synthetase (EPRS)
TRV-0044367-01 10 µg

Recombinant Glutamyl Prolyl tRNA Synthetase (EPRS)

Sign In for Pricing
View Details
Recombinant Glutamyl Prolyl tRNA Synthetase (EPRS)
TRV-0044367-02 50 µg

Recombinant Glutamyl Prolyl tRNA Synthetase (EPRS)

Sign In for Pricing
View Details
Recombinant Glutamyl Prolyl tRNA Synthetase (EPRS)
TRV-0044367-03 100 µg

Recombinant Glutamyl Prolyl tRNA Synthetase (EPRS)

Sign In for Pricing
View Details