ARL6IP6, Human (HEK293, Fc)
ARL6IP6 Protein is present in the inner nuclear membrane and displays transmembrane characteristics. ARL6IP6 gene plays a role in the activation of NF-κB and in the regulation of cell growth and apoptosis. ARL6IP6 can be used in research of cutis marmorata telangiectatica (CMTC) . ARL6IP6 Protein, Human (HEK293, Fc) is the recombinant human-derived ARL6IP6 protein, expressed by HEK293 , with N-mFc labeled tag.
Product Specifications
Product Name Alternative
ARL6IP6 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/arl6ip6-protein-human-hek293-fc.html
Purity
95.0
Smiles
MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLS
Molecular Formula
151188 (Gene_ID) Q8N6S5/NP_689735.1 (M1-S110) (Accession)
Molecular Weight
Approximately 34-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Sheep Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit
Sheep Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit
Sheep Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit
Sheep Fructose-1,6-Bisphosphatase Isozyme 2 (FBP2) ELISA Kit
