Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Petrosia ficiformis Silicatein

Product Specifications

Product Name Alternative

; Silicatein; EC 3.4.22.-

Abbreviation

Recombinant Petrosia ficiformis Silicatein protein

UniProt

Q6YD92

Expression Region

123-339aa

Organism

Petrosia ficiformis (Common Mediterranean sponge)

Target Sequence

LPETVDWRTGGAVTHVKDQLRCGCSYAFAAVGALEGAAALARGRTASLSEQNVLDCSVPYGNHGCSCEDVNNAFMYVIDNGGLDTTSSYPYVSRQYYCKFKSSGVGATATGIVTISSGDESSLESALATAGPVAVYIDASHSSFQFYKYGVLNVPNCSRSKLSHAMILIGYGTTSSKKYWLLKNSWGPNWGISGYIKMSRGMSNQCGIATYASFPTL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Polymerizes silica around the axial filament during spicule formation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.5 kDa

References & Citations

"Primary structure and post-translational modifications of silicatein beta from the marine sponge Petrosia ficiformis (Poiret, 1789) ." Armirotti A., Damonte G., Pozzolini M., Mussino F., Cerrano C., Salis A., Benatti U., Giovine M. J. Proteome Res. 8:3995-4004 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnip1 (NM_027398) Mouse Tagged ORF Clone Lentiviral Particle
MR202394L3V 200 µL

Kcnip1 (NM_027398) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human DLL4 Antibody , APC
E55A08787 50 Tests

Human DLL4 Antibody , APC

Sign In for Pricing
View Details
Ppid Rat shRNA Plasmid (Locus ID 361967)
TL700618 1 Kit

Ppid Rat shRNA Plasmid (Locus ID 361967)

Sign In for Pricing
View Details
Recombinant Mouse OLFR13 Protein, His (Fc)-Avi-tagged
OLFR13-6343M 50 µg

Recombinant Mouse OLFR13 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Chicken TOP2B ELISA Kit
E100982-01 1 Each

Chicken TOP2B ELISA Kit

Sign In for Pricing
View Details
Chicken TOP2B ELISA Kit
E100982-02 1 Each

Chicken TOP2B ELISA Kit

Sign In for Pricing
View Details