Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/8280R) [Alexa Fluor 405]
NBP3-23986AF405 0.1 mL

Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/8280R) [Alexa Fluor 405]

Sign In for Pricing
View Details
K562
ARC0380 1 Million

K562

Sign In for Pricing
View Details
GENLISA Canine Troponin I Type 3, Cardiac (TNNI3) ELISA
KLN0910 1x 96 Well

GENLISA Canine Troponin I Type 3, Cardiac (TNNI3) ELISA

Sign In for Pricing
View Details
HK1 Rabbit mAb (AMR13182N)
AMR13182N-01 50 µL

HK1 Rabbit mAb (AMR13182N)

Sign In for Pricing
View Details
HK1 Rabbit mAb (AMR13182N)
AMR13182N-02 100 µL

HK1 Rabbit mAb (AMR13182N)

Sign In for Pricing
View Details
HK1 Rabbit mAb (AMR13182N)
AMR13182N-03 200 µL

HK1 Rabbit mAb (AMR13182N)

Sign In for Pricing
View Details