Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MRPL42 Antibody [Alexa Fluor 488]
NBP2-97198AF488 0.1 mL

Rabbit Polyclonal MRPL42 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
DiagPoly™ Azide Polystyrene Particles, 5 μm, Low Density
DNB-PCC01 1 mL

DiagPoly™ Azide Polystyrene Particles, 5 μm, Low Density

Sign In for Pricing
View Details
CTNS (CTNS, PQLC4, CTNS-LSB) (MaxLight 550)
MBS6445982-01 0.1 mL

CTNS (CTNS, PQLC4, CTNS-LSB) (MaxLight 550)

Sign In for Pricing
View Details
CTNS (CTNS, PQLC4, CTNS-LSB) (MaxLight 550)
MBS6445982-02 5x 0.1 mL

CTNS (CTNS, PQLC4, CTNS-LSB) (MaxLight 550)

Sign In for Pricing
View Details
RTN4RL1 Antibody, Biotin conjugated
A60603-100UG 100 µg

RTN4RL1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Usp7 3'UTR Luciferase Stable Cell Line
TU121690 1.0 mL

Usp7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details