Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine ADV-Ag ELISA Kit
EPA0749 96 Tests

Porcine ADV-Ag ELISA Kit

Sign In for Pricing
View Details
Interleukin 36 Gamma (IL36G) Antibody
abx405904-01 100 µL

Interleukin 36 Gamma (IL36G) Antibody

Sign In for Pricing
View Details
Interleukin 36 Gamma (IL36G) Antibody
abx405904-02 200 µL

Interleukin 36 Gamma (IL36G) Antibody

Sign In for Pricing
View Details
Interleukin 36 Gamma (IL36G) Antibody
abx405904-03 1 mL

Interleukin 36 Gamma (IL36G) Antibody

Sign In for Pricing
View Details
Caprisil NH2 HPLC Column, 5 µm, 100 Å, CA553-A x 50 mm
CA553-A 5 µm

Caprisil NH2 HPLC Column, 5 µm, 100 Å, CA553-A x 50 mm

Sign In for Pricing
View Details
Rabbit Polyclonal OGFOD1 Antibody [CoraFluor 1]
NBP2-97921CL1 0.1 mL

Rabbit Polyclonal OGFOD1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details