Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ rno-miR-632 miRNA Agomir/Antagomir
AM4992 2 OD, 4 OD, 50 OD

MIRacle™ rno-miR-632 miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Human KIF20A (Kinesin Family, Member 20A) ELISA Kit
EK243182 96 Well

Human KIF20A (Kinesin Family, Member 20A) ELISA Kit

Sign In for Pricing
View Details
SMAD7 (AcK70) Blocking Peptide
CBP6226-01 1 mg

SMAD7 (AcK70) Blocking Peptide

Sign In for Pricing
View Details
SMAD7 (AcK70) Blocking Peptide
CBP6226-02 5 mg

SMAD7 (AcK70) Blocking Peptide

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L)
BS21043-01 100 µL

Mouse Anti-Monkey IgG (H&L)

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L)
BS21043-02 500 µL

Mouse Anti-Monkey IgG (H&L)

Sign In for Pricing
View Details