Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Erythrocyte Specific Antibody (SFL23.6) [DyLight 405]
NBP2-34715V 0.1 mL

Mouse Monoclonal Erythrocyte Specific Antibody (SFL23.6) [DyLight 405]

Sign In for Pricing
View Details
Rabbit Polyclonal RRAGB Antibody [Alexa Fluor 350]
NBP2-97877AF350 0.1 mL

Rabbit Polyclonal RRAGB Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
CCDC65 (NM_033124) Human Over-expression Lysate
LY409729 100 µg

CCDC65 (NM_033124) Human Over-expression Lysate

Sign In for Pricing
View Details
JMJD1A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV811958 1.0 µg DNA

JMJD1A Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rabbit Polyclonal Symplekin Antibody [CoraFluor 1]
NB100-74590CL1 0.1 mL

Rabbit Polyclonal Symplekin Antibody [CoraFluor 1]

Sign In for Pricing
View Details
ent-Pazufloxacin Mesylate
TRC-P211005-500MG 500 mg

ent-Pazufloxacin Mesylate

Sign In for Pricing
View Details