Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OBFC1 (10O2) Mouse Monoclonal antibody
E28PE4679 100 µL

OBFC1 (10O2) Mouse Monoclonal antibody

Sign In for Pricing
View Details
C17orf80 (NM_017941) Human Tagged ORF Clone Lentiviral Particle
RC200157L3V 200 µL

C17orf80 (NM_017941) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Plant Phospholipase A2, Pancreas (pPLA2) ELISA Kit
MBS9375885 Inquire

Plant Phospholipase A2, Pancreas (pPLA2) ELISA Kit

Sign In for Pricing
View Details
SLC35A2 (NM_001282651) Human Tagged ORF Clone
RG238124 10 µg

SLC35A2 (NM_001282651) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human B3GNT4, His-tagged
B3GNT4-10105H 25 µg

Recombinant Human B3GNT4, His-tagged

Sign In for Pricing
View Details
Recombinant Human PTPRZ1 Protein, His, Yeast-10ug
QP6557-ye-10ug 10ug

Recombinant Human PTPRZ1 Protein, His, Yeast-10ug

Sign In for Pricing
View Details