Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Treponema Pallidum TP_0148 Protein (aa 1-192)
VAng-Cr0985-1mgEcoli 1 mg (E. coli)

Recombinant Treponema Pallidum TP_0148 Protein (aa 1-192)

Sign In for Pricing
View Details
Anti-Human IgG (H+L) - 70nm Gold NanoUrchins
GUAC-70-03-15 1 mL

Anti-Human IgG (H+L) - 70nm Gold NanoUrchins

Sign In for Pricing
View Details
CCL23 discontinued
534180-01 30ul

CCL23 discontinued

Sign In for Pricing
View Details
CCL23 discontinued
534180-02 100 µL

CCL23 discontinued

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Elongation factor Tu (tuf)
MBS1109032-01 0.02 mg (E-Coli)

Recombinant Mycoplasma genitalium Elongation factor Tu (tuf)

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Elongation factor Tu (tuf)
MBS1109032-02 0.02 mg (Yeast)

Recombinant Mycoplasma genitalium Elongation factor Tu (tuf)

Sign In for Pricing
View Details