Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RMI2 shRNA (UAS) - Lentiviral human RMI2 shRNA (UAS, GFP) plasmid
GTR15330169 1 Vial

Lentiviral human RMI2 shRNA (UAS) - Lentiviral human RMI2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Canine Dopa Decarboxylase (DDC) ELISA Kit
NSL0245Ca 96 Tests

Canine Dopa Decarboxylase (DDC) ELISA Kit

Sign In for Pricing
View Details
Dentin Sialophosphoprotein (DSPP) Monoclonal Antibody
CAU36463-01 100 µL

Dentin Sialophosphoprotein (DSPP) Monoclonal Antibody

Sign In for Pricing
View Details
Dentin Sialophosphoprotein (DSPP) Monoclonal Antibody
CAU36463-02 200 µL

Dentin Sialophosphoprotein (DSPP) Monoclonal Antibody

Sign In for Pricing
View Details
Dentin Sialophosphoprotein (DSPP) Monoclonal Antibody
CAU36463-03 1 mL

Dentin Sialophosphoprotein (DSPP) Monoclonal Antibody

Sign In for Pricing
View Details
Staphylococcal enterotoxin E
AG122 1 mg

Staphylococcal enterotoxin E

Sign In for Pricing
View Details