Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Glycine N-Methyltransferase/GNMT Protein (N-6His)
E53A06194 50 µg

Recombinant Human Glycine N-Methyltransferase/GNMT Protein (N-6His)

Sign In for Pricing
View Details
Tris Buffer 0.5M, pH 7.0
42020349-1 500 mL

Tris Buffer 0.5M, pH 7.0

Sign In for Pricing
View Details
Rabbit anti-MN1 Antibody
YLD5091-01 50 µL

Rabbit anti-MN1 Antibody

Sign In for Pricing
View Details
Rabbit anti-MN1 Antibody
YLD5091-02 100 µL

Rabbit anti-MN1 Antibody

Sign In for Pricing
View Details
ETV4 (ETS Translocation Variant 4, Adenovirus E1A Enhancer-binding Protein, E1A-F, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, E1AF, PEA3) discontinued
360204-01 50 µL

ETV4 (ETS Translocation Variant 4, Adenovirus E1A Enhancer-binding Protein, E1A-F, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, E1AF, PEA3) discontinued

Sign In for Pricing
View Details
ETV4 (ETS Translocation Variant 4, Adenovirus E1A Enhancer-binding Protein, E1A-F, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, E1AF, PEA3) discontinued
360204-02 100 µL

ETV4 (ETS Translocation Variant 4, Adenovirus E1A Enhancer-binding Protein, E1A-F, Polyomavirus Enhancer Activator 3 Homolog, Protein PEA3, E1AF, PEA3) discontinued

Sign In for Pricing
View Details