Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRS2 (NM_001278355) Human Tagged ORF Clone
RG238622 10 µg

FRS2 (NM_001278355) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-RHOBTB2 antibody
STJ11100386 100 µl

Anti-RHOBTB2 antibody

Sign In for Pricing
View Details
SF3A3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV785711 1.0 µg DNA

SF3A3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Cytochrome P450 4B1 (CYP4B1) Antibody
abx034045-01 80 µL

Cytochrome P450 4B1 (CYP4B1) Antibody

Sign In for Pricing
View Details
Cytochrome P450 4B1 (CYP4B1) Antibody
abx034045-02 400 µL

Cytochrome P450 4B1 (CYP4B1) Antibody

Sign In for Pricing
View Details
Nup98 Monoclonal Antibody
JOT-MCA0951-01 50ul

Nup98 Monoclonal Antibody

Sign In for Pricing
View Details