Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque PEX13 Protein, His (Fc)-Avi-tagged
PEX13-3193R 50 µg

Recombinant Rhesus Macaque PEX13 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
mGluR7 Antibody
ABF0171 100 µg

mGluR7 Antibody

Sign In for Pricing
View Details
ZNF17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2681207 1.0 µg DNA

ZNF17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
UIMC1 Polyclonal Antibody
UB-GEN-6214 100 µL

UIMC1 Polyclonal Antibody

Sign In for Pricing
View Details
Rpl38 3'UTR Luciferase Stable Cell Line
TU118106 1.0 mL

Rpl38 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Aars2 Rat siRNA Oligo Duplex (Locus ID 301254)
SR504429 1 Kit

Aars2 Rat siRNA Oligo Duplex (Locus ID 301254)

Sign In for Pricing
View Details