Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-519d-5p miRNA Antagomir
MBS8318002-01 10 nmol

hsa-miR-519d-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-519d-5p miRNA Antagomir
MBS8318002-02 20 nmol

hsa-miR-519d-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-519d-5p miRNA Antagomir
MBS8318002-03 5x 20 nmol

hsa-miR-519d-5p miRNA Antagomir

Sign In for Pricing
View Details
KAT8 (NM_182958) Human Tagged ORF Clone Lentiviral Particle
RC215692L4V 200 µL

KAT8 (NM_182958) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ACSS2 ORF Vector (Human) (pORF)
ORF000116 1.0 µg DNA

ACSS2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Sheep Complement Serum
CTS-020 5 mL

Sheep Complement Serum

Sign In for Pricing
View Details