PD-1, Human (HEK293, His)
PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.
Product Specifications
Product Name Alternative
PD-1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html
Purity
98.0
Smiles
LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH
Molecular Formula
5133 (Gene_ID) Q15116 (L25-Q167) (Accession)
Molecular Weight
30-42 kDa
References & Citations
[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 (AHA1) Antibody (ATTO390)
PDLIM1, CT (PDLIM1, CLIM1, CLP36, PDZ and LIM domain protein 1, C-terminal LIM domain protein 1, Elfin, LIM domain protein CLP-36) (MaxLight 750)
PDLIM1, CT (PDLIM1, CLIM1, CLP36, PDZ and LIM domain protein 1, C-terminal LIM domain protein 1, Elfin, LIM domain protein CLP-36) (MaxLight 750)