Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf58 Human Gene Knockout Kit (CRISPR)
KN420776 1 Kit

CXorf58 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Monoclonal TRAF-1 Antibody (TRAF1/2770) [Alexa Fluor 405]
NBP2-79924AF405 0.1 mL

Mouse Monoclonal TRAF-1 Antibody (TRAF1/2770) [Alexa Fluor 405]

Sign In for Pricing
View Details
Anti-TudorSN antibody
STJ98437 100 µl

Anti-TudorSN antibody

Sign In for Pricing
View Details
Human IL27RA knockout cell line
ABC-KH7332 1 Vial

Human IL27RA knockout cell line

Sign In for Pricing
View Details
Recombinant Human SELP Protein, Fc His Tag
KMP1810 50 µg

Recombinant Human SELP Protein, Fc His Tag

Sign In for Pricing
View Details
Rpl15 sgRNA CRISPR Lentivector set (Rat)
K7194101 3x 1.0 µg

Rpl15 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details