Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aven Rat siRNA Oligo Duplex (Locus ID 311299)
SR504763 1 Kit

Aven Rat siRNA Oligo Duplex (Locus ID 311299)

Sign In for Pricing
View Details
Tmem63b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3628805 3x 1.0 µg

Tmem63b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TMPRSS11D Protein Vector (Rat) (pPM-C-HA)
PV311936 500 ng

TMPRSS11D Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RNU6-71 Adenovirus (Human)
40497051 1.0 mL

RNU6-71 Adenovirus (Human)

Sign In for Pricing
View Details
1L RPMI 1640 with L-glutamine
10-040-CM-01 6 / PCK

1L RPMI 1640 with L-glutamine

Sign In for Pricing
View Details
1L RPMI 1640 with L-glutamine
10-040-CM-02 6 / PCK

1L RPMI 1640 with L-glutamine

Sign In for Pricing
View Details