Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Collagen Type I (Col I) ELISA Kit
QY-E11636 96 Tests

Rat Collagen Type I (Col I) ELISA Kit

Sign In for Pricing
View Details
CAMK2G, CT (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit gamma, CaM-kinase II Subunit gamma, CaM Kinase II Subunit gamma, CAMKG) (MaxLight 405) discontinued
C1035-25Z-ML405 100 µL

CAMK2G, CT (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit gamma, CaM-kinase II Subunit gamma, CaM Kinase II Subunit gamma, CAMKG) (MaxLight 405) discontinued

Sign In for Pricing
View Details
EAP30 (G-8)
sc-514147 200 µg/mL

EAP30 (G-8)

Sign In for Pricing
View Details
Adcy7 ORF Vector (Mouse) (pORF)
ORF038153 1.0 µg DNA

Adcy7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
NRP2 Antibody
E30AOC296 100 µL

NRP2 Antibody

Sign In for Pricing
View Details
ALT2, Recombinant, Human, His-Tag, aa1-523
046025-01 20 µg

ALT2, Recombinant, Human, His-Tag, aa1-523

Sign In for Pricing
View Details