Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-1, Human (HEK293, His)

PD-1 Protein, Human (HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Product Specifications

Product Name Alternative

PD-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-1-protein-human-143a-a-hek293-his.html

Purity

98.0

Smiles

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Formula

5133 (Gene_ID) Q15116 (L25-Q167) (Accession)

Molecular Weight

30-42 kDa

References & Citations

[1]Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18 (12) :e731-e741.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL28, CT (KLHL28, BTBD5, Kelch-like protein 28, BTB/POZ domain-containing protein 5) (Azide free) (HRP) discontinued
037555-HRP 200 µL

KLHL28, CT (KLHL28, BTBD5, Kelch-like protein 28, BTB/POZ domain-containing protein 5) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
ABCG8 (NM_022437) Human Tagged Lenti ORF Clone
RC220827L1 10 µg

ABCG8 (NM_022437) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human/Mouse sFRP-3 MAb (Clone 133912)
MAB192-050 50 µg

Human/Mouse sFRP-3 MAb (Clone 133912)

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG (H&L) - AcalephFluor568
CSA3527-01 100 µL

Rabbit Anti-Mouse IgG (H&L) - AcalephFluor568

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG (H&L) - AcalephFluor568
CSA3527-02 500 μL

Rabbit Anti-Mouse IgG (H&L) - AcalephFluor568

Sign In for Pricing
View Details
Rabbit Anti-Mouse IgG (H&L) - AcalephFluor568
CSA3527-03 1 mL

Rabbit Anti-Mouse IgG (H&L) - AcalephFluor568

Sign In for Pricing
View Details