Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus Non-structural glycoprotein 4, partial

Product Specifications

Abbreviation

Recombinant Rotavirus Non-structural glycoprotein 4 protein, partial

UniProt

A9Q1L1

Expression Region

73-213aa

Organism

Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219) )

Target Sequence

QTSKIIYIVRLLFWKMYNVINNLVNKMINREKIADRQIVDNRFREFEERFRILLLQHDENIAKQDNIVQYNKLDNFAESIKSEFNLKVAEMERRFQELKWRCDMIANKTMNTIVLTNTVDSTNKDEKIIFDEGSVVQYNRE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Cis-aconitate decarboxylase that catalyzes production of itaconate and is involved in the inhibition of the inflammatory response. Acts as a negative regulator of the Toll-like receptors (TLRs) -mediated inflammatory innate response by stimulating the tumor necrosis factor alpha-induced protein TNFAIP3 expression via reactive oxygen species (ROS) in LPS-tolerized macrophages. Involved in antimicrobial response of innate immune cells; ACOD1-mediated itaconic acid production contributes to the antimicrobial activity of macrophages by generating itaconate, leading to alkylation of proteins, such as TFEB. Involved in antiviral response following infection by flavivirus in neurons: ACOD1-mediated itaconate production inhibits the activity of succinate dehydrogenase, generating a metabolic state in neurons that suppresses replication of viral genomes. Plays a role in the embryo implantation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.2 kDa

References & Citations

"Myc-dependent endothelial proliferation is controlled by phosphotyrosine 1212 in VEGF receptor-2." Testini C., Smith R.O., Jin Y., Martinsson P., Sun Y., Hedlund M., Sainz-Jaspeado M., Shibuya M., Hellstrom M., Claesson-Welsh L. EMBO Rep 20:e47845-e47845 (2019)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SUPT5H, ID (SUPT5H, SPT5, SPT5H, Transcription elongation factor SPT5, DRB sensitivity-inducing factor 160kD subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein) (Biotin)
MBS6352634-01 0.2 mL

SUPT5H, ID (SUPT5H, SPT5, SPT5H, Transcription elongation factor SPT5, DRB sensitivity-inducing factor 160kD subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein) (Biotin)

Ask
View Details
SUPT5H, ID (SUPT5H, SPT5, SPT5H, Transcription elongation factor SPT5, DRB sensitivity-inducing factor 160kD subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein) (Biotin)
MBS6352634-02 5x 0.2 mL

SUPT5H, ID (SUPT5H, SPT5, SPT5H, Transcription elongation factor SPT5, DRB sensitivity-inducing factor 160kD subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein) (Biotin)

Ask
View Details
Rabbit Polyclonal MORF4 Antibody [FITC]
NBP1-76809F 0.1 mL

Rabbit Polyclonal MORF4 Antibody [FITC]

Ask
View Details
Laminin alpha-5 discontinued
391020 200 µL

Laminin alpha-5 discontinued

Ask
View Details
RFT1, CT (RFT1, Protein RFT1 homolog)
MBS642195-01 0.2 mL

RFT1, CT (RFT1, Protein RFT1 homolog)

Ask
View Details
RFT1, CT (RFT1, Protein RFT1 homolog)
MBS642195-02 5x 0.2 mL

RFT1, CT (RFT1, Protein RFT1 homolog)

Ask
View Details