Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22, Mouse (CHO)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IL-22 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-22-protein-mouse-cho.html

Purity

95.00

Smiles

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Molecular Formula

50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AKR7A3 (Aflatoxin B1 aldehyde reductase member 3, AFB1 aldehyde reductase 2, AFB1-AR 2, AFAR2)
305138-01 50 µL

AKR7A3 (Aflatoxin B1 aldehyde reductase member 3, AFB1 aldehyde reductase 2, AFB1-AR 2, AFAR2)

Ask
View Details
AKR7A3 (Aflatoxin B1 aldehyde reductase member 3, AFB1 aldehyde reductase 2, AFB1-AR 2, AFAR2)
305138-02 100 µL

AKR7A3 (Aflatoxin B1 aldehyde reductase member 3, AFB1 aldehyde reductase 2, AFB1-AR 2, AFAR2)

Ask
View Details
Mouse Monoclonal Antibody to POLR2A
MBS8575588-01 0.1 mL

Mouse Monoclonal Antibody to POLR2A

Ask
View Details
Mouse Monoclonal Antibody to POLR2A
MBS8575588-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to POLR2A

Ask
View Details
Mouse Monoclonal Antibody to POLR2A
MBS8575588-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to POLR2A

Ask
View Details
Mouse Monoclonal Antibody to POLR2A
MBS8575588-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to POLR2A

Ask
View Details