Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22, Mouse (CHO)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IL-22 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-22-protein-mouse-cho.html

Purity

95.00

Smiles

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Molecular Formula

50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ILT8/CD85b/LILRA6 Antibody (921330) [Allophycocyanin/Cy7]
FAB8656APCCY7 0.1 mL

Mouse Monoclonal ILT8/CD85b/LILRA6 Antibody (921330) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Rabbit Anti-H2AW/H2AW Polyclonal Antibody
PAV1671 100 μL

Rabbit Anti-H2AW/H2AW Polyclonal Antibody

Sign In for Pricing
View Details
PPC1 Antibody
PHY2037A 150 μg

PPC1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ST3GAL4 Antibody [Alexa Fluor 350]
NBP2-97314AF350 0.1 mL

Rabbit Polyclonal ST3GAL4 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
GPC4, NT (Glypican-4, K-glypican, Secreted Glypican-4, UNQ474/PRO937) (MaxLight 650)
MBS6478613-01 0.1 mL

GPC4, NT (Glypican-4, K-glypican, Secreted Glypican-4, UNQ474/PRO937) (MaxLight 650)

Sign In for Pricing
View Details
GPC4, NT (Glypican-4, K-glypican, Secreted Glypican-4, UNQ474/PRO937) (MaxLight 650)
MBS6478613-02 5x 0.1 mL

GPC4, NT (Glypican-4, K-glypican, Secreted Glypican-4, UNQ474/PRO937) (MaxLight 650)

Sign In for Pricing
View Details