IL-22, Mouse (CHO)
IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free.
Product Specifications
Product Name Alternative
IL-22 Protein, Mouse (CHO), Mouse, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-22-protein-mouse-cho.html
Purity
95.00
Smiles
LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Molecular Formula
50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)
Molecular Weight
Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Cryostore Storage Box Type T314-281Y, yellow PU= 4 pieces - for 1 ml - 2 ml Cryogenic Tubes - 133 x 133 x 52 mm - numerically marked on the grid and lid
SOX15 (SRY (Sex Determining Region Y)-Box 15, SOX20, SOX26, SOX27) (AP)
SOX15 (SRY (Sex Determining Region Y)-Box 15, SOX20, SOX26, SOX27) (AP)
Lentiviral human NOTUM sgRNA gene knockout kit - Lentiviral human NOTUM sgRNA gene knockout kit (100)