Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22, Mouse (CHO)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IL-22 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-22-protein-mouse-cho.html

Purity

95.00

Smiles

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Molecular Formula

50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VOC Mixture, 8 components, 100ug/ml each of in Methanol
F263368 1 mL

VOC Mixture, 8 components, 100ug/ml each of in Methanol

Sign In for Pricing
View Details
Olfr782 Lentiviral Activation Particles (m)
sc-434319-LAC 200 µL

Olfr782 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
MT4 Antibody (FITC)
orb27687-01 50 µg

MT4 Antibody (FITC)

Sign In for Pricing
View Details
MT4 Antibody (FITC)
orb27687-02 100 µg

MT4 Antibody (FITC)

Sign In for Pricing
View Details
CXXC5 Polyclonal Antibody, HRP Conjugated
bs-6890R-HRP 100 µL

CXXC5 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
CD14 (Monocyte/Macrophage Marker)
MBS4380319-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD14 (Monocyte/Macrophage Marker)

Sign In for Pricing
View Details