Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22, Mouse (CHO)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IL-22 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-22-protein-mouse-cho.html

Purity

95.00

Smiles

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Molecular Formula

50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)

Molecular Weight

Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECAM-1 (D-11) Alexa Fluor® 647
sc-46694 AF647 200 µg/mL

PECAM-1 (D-11) Alexa Fluor® 647

Sign In for Pricing
View Details
ADAMTS2 ELISA Kit (Mouse) (OKEH05251)
OKEH05251 96 Well

ADAMTS2 ELISA Kit (Mouse) (OKEH05251)

Sign In for Pricing
View Details
OR2T12 Antibody - C-terminal region : HRP (ARP71046_P050-HRP)
ARP71046_P050-HRP 100 µL

OR2T12 Antibody - C-terminal region : HRP (ARP71046_P050-HRP)

Sign In for Pricing
View Details
Recombinant Human BRCA1-A complex subunit RAP80 (UIMC1)
MBS1361722-01 0.02 mg (E-Coli)

Recombinant Human BRCA1-A complex subunit RAP80 (UIMC1)

Sign In for Pricing
View Details
Recombinant Human BRCA1-A complex subunit RAP80 (UIMC1)
MBS1361722-02 0.02 mg (Yeast)

Recombinant Human BRCA1-A complex subunit RAP80 (UIMC1)

Sign In for Pricing
View Details
Recombinant Human BRCA1-A complex subunit RAP80 (UIMC1)
MBS1361722-03 0.1 mg (Yeast)

Recombinant Human BRCA1-A complex subunit RAP80 (UIMC1)

Sign In for Pricing
View Details