Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKG2A, Mouse (HEK293, His)

NKG2A Protein, a crucial immune inhibitory receptor, forms a complex with KLRD1 on lymphocyte subsets for self-nonself discrimination.Recognizing HLA-E loaded with self-peptides, it monitors MHC class I expression in healthy cells, promoting self-tolerance.NKG2A transmits signals through ITIMs, recruiting tyrosine phosphatases to counteractivate receptors.As a key inhibitor on NK cells, it regulates their functions, distinguishing harmless from pathogenic antigens.In the tumor microenvironment, NKG2A acts as an immune inhibitory checkpoint, contributing to cell exhaustion.During viral infection, it inhibits NK cell cytotoxicity, facilitating viral immune escape.NKG2A Protein, Mouse (HEK293, His) is the recombinant mouse-derived NKG2A protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

NKG2A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nkg2a-protein-mouse-hek293-his.html

Purity

97.50

Smiles

ATPYNEANAQINSSMTRTHRDINYTLSSAQPCPHCPKEWISYSHNCYFIGMERKSWNDSLVSCISKNCSLLHIDSEEEQDFLQSLSLVSWTGILRKGRGQPWVWKKDSIFKPKIAEILHDECNCAMMSASGLTADSCTTLHPYLCKCKFPI

Molecular Formula

16641 (Gene_ID) Q9WU31 (A94-I244) (Accession)

Molecular Weight

33-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF640R conjugate, 0.1mg/mL
BNC401922-500 1x 500 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), CF568 conjugate, 0.1mg/mL
BNC681634-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb240), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (E67), CF488A conjugate, 0.1mg/mL
BNC880673-500 1x 500 µL

Cyclin A2 (E67), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details