Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACE/CD143, Human (His)

ACE/CD143 Protein, Human (His) is a recombinant human Angiotensin-converting enzyme/CD143 a His tag at the C-terminus. Angiotensin I-converting enzyme (ACE, CD143) hydrolyzes small peptides such as angiotensin I, bradykinin, substance P, LH-RH and several others and thus plays a key role in blood pressure regulation and vascular remodeling. ACE plays a crucial role in blood pressure regulation, vascular remodeling, and immunity[1].

Product Specifications

Product Name Alternative

ACE/CD143 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ace-cd143-protein-human-his.html

Purity

95.00

Smiles

LVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNS

Molecular Formula

1636 (Gene_ID) P12821 (L642-S1230) (Accession)

Molecular Weight

Approximately 68.0 kDa

References & Citations

[1]Danilov SM, et al. Angiotensin I-converting enzyme Gln1069Arg mutation impairs trafficking to the cell surface resulting in selective denaturation of the C-domain. PLoS One. 2010;5 (5) :e10438. Published 2010 May 3.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLCN (NM_144606) Human Recombinant Protein
TP761774 50 µg

FLCN (NM_144606) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS629788 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
NBL1 Antibody (Biotin)
KB-8114-01 50 μL

NBL1 Antibody (Biotin)

Sign In for Pricing
View Details
NBL1 Antibody (Biotin)
KB-8114-02 100 µL

NBL1 Antibody (Biotin)

Sign In for Pricing
View Details
NBL1 Antibody (Biotin)
KB-8114-03 1 mL

NBL1 Antibody (Biotin)

Sign In for Pricing
View Details
Human GLUT12 (SLC2A12) activation kit by CRISPRa
GA115884 1 Kit

Human GLUT12 (SLC2A12) activation kit by CRISPRa

Sign In for Pricing
View Details