Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACE/CD143, Human (His)

ACE/CD143 Protein, Human (His) is a recombinant human Angiotensin-converting enzyme/CD143 a His tag at the C-terminus. Angiotensin I-converting enzyme (ACE, CD143) hydrolyzes small peptides such as angiotensin I, bradykinin, substance P, LH-RH and several others and thus plays a key role in blood pressure regulation and vascular remodeling. ACE plays a crucial role in blood pressure regulation, vascular remodeling, and immunity[1].

Product Specifications

Product Name Alternative

ACE/CD143 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ace-cd143-protein-human-his.html

Purity

95.00

Smiles

LVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNS

Molecular Formula

1636 (Gene_ID) P12821 (L642-S1230) (Accession)

Molecular Weight

Approximately 68.0 kDa

References & Citations

[1]Danilov SM, et al. Angiotensin I-converting enzyme Gln1069Arg mutation impairs trafficking to the cell surface resulting in selective denaturation of the C-domain. PLoS One. 2010;5 (5) :e10438. Published 2010 May 3.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal OMgp Antibody (1A8)
H00004974-M06 0.1 mg

Mouse Monoclonal OMgp Antibody (1A8)

Sign In for Pricing
View Details
BC030476 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4229907 1.0 µg DNA

BC030476 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit anti-rat Beta-2 adrenergic receptor polyclonal Antibody, Biotin conjugated
MBS1491734-01 0.05 mg

Rabbit anti-rat Beta-2 adrenergic receptor polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-rat Beta-2 adrenergic receptor polyclonal Antibody, Biotin conjugated
MBS1491734-02 0.1 mg

Rabbit anti-rat Beta-2 adrenergic receptor polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-rat Beta-2 adrenergic receptor polyclonal Antibody, Biotin conjugated
MBS1491734-03 5x 0.1 mg

Rabbit anti-rat Beta-2 adrenergic receptor polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Speg ORF Vector (Mouse) (pORF)
ORF058314 1.0 µg DNA

Speg ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details