Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLM1, Human (His, Solution)

GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His, Solution) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GOLM1 Protein, Human (His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/golm1-protein-human-his-solution.html

Purity

95.0

Smiles

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Molecular Formula

51280 (Gene_ID) Q8NBJ4-1 (S36-L401) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ)
MBS6007640-01 0.1 mg

TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ)

Ask
View Details
TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ)
MBS6007640-02 5x 0.1 mg

TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ)

Ask
View Details
Voreloxin 25mg
A14158-25 25 mg

Voreloxin 25mg

Ask
View Details
R-268712 200mg
A16207-200 200 mg

R-268712 200mg

Ask
View Details
Recombinant human ACE2 protein with C-terminal human Fc tag
MBS188116-01 0.01 mg

Recombinant human ACE2 protein with C-terminal human Fc tag

Ask
View Details
Recombinant human ACE2 protein with C-terminal human Fc tag
MBS188116-02 0.05 mg

Recombinant human ACE2 protein with C-terminal human Fc tag

Ask
View Details