Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLM1, Human (His, Solution)

GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His, Solution) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GOLM1 Protein, Human (His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/golm1-protein-human-his-solution.html

Purity

95.0

Smiles

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Molecular Formula

51280 (Gene_ID) Q8NBJ4-1 (S36-L401) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GNB5 knockdown cell line
ABC-KD6190 1 Vial

Human GNB5 knockdown cell line

Sign In for Pricing
View Details
MB-Rluc (GFP) Lentivirus in PBS
LVP1024-G-PBS 1x 10^8 IFU/mL - 200 μL

MB-Rluc (GFP) Lentivirus in PBS

Sign In for Pricing
View Details
Mouse Monoclonal CD41/CD61 Antibody (P256) [DyLight 488]
NBP2-50443G 0.1 mL

Mouse Monoclonal CD41/CD61 Antibody (P256) [DyLight 488]

Sign In for Pricing
View Details
FAM162B Lentiviral Activation Particles (m)
sc-429517-LAC 200 µL

FAM162B Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Recombinant Mouse VSIG2 Protein, N-His
MBS1579207-01 0.1 mg

Recombinant Mouse VSIG2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse VSIG2 Protein, N-His
MBS1579207-02 1 mg

Recombinant Mouse VSIG2 Protein, N-His

Sign In for Pricing
View Details