Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLM1, Human (His, Solution)

GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His, Solution) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GOLM1 Protein, Human (His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/golm1-protein-human-his-solution.html

Purity

95.0

Smiles

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Molecular Formula

51280 (Gene_ID) Q8NBJ4-1 (S36-L401) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arhgap33 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
12303114 3x 1.0 µg

Arhgap33 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Aluminium isopropoxide
GK9569-100g 100 g

Aluminium isopropoxide

Sign In for Pricing
View Details
STRAP Adenovirus (Human)
45774051 1.0 mL

STRAP Adenovirus (Human)

Sign In for Pricing
View Details
Kir4.1 (KCNJ10) (NM_002241) Human Over-expression Lysate
LH06095V 100 µg

Kir4.1 (KCNJ10) (NM_002241) Human Over-expression Lysate

Sign In for Pricing
View Details
Mmu-miR-223-5p miRNA Mimic
CMM0897-01 5 nmol

Mmu-miR-223-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-223-5p miRNA Mimic
CMM0897-02 10 nmol

Mmu-miR-223-5p miRNA Mimic

Sign In for Pricing
View Details