Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLM1, Human (His, Solution)

GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His, Solution) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GOLM1 Protein, Human (His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/golm1-protein-human-his-solution.html

Purity

95.0

Smiles

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Molecular Formula

51280 (Gene_ID) Q8NBJ4-1 (S36-L401) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Psen1 (NM_008943) Mouse Tagged ORF Clone
MG207460 10 µg

Psen1 (NM_008943) Mouse Tagged ORF Clone

Ask
View Details
Cd52 (NM_053983) Rat Tagged Lenti ORF Clone
RR208405L3 10 µg

Cd52 (NM_053983) Rat Tagged Lenti ORF Clone

Ask
View Details
CD35 (E-11) Alexa Fluor® 790
sc-7308 AF790 200 µg/mL

CD35 (E-11) Alexa Fluor® 790

Ask
View Details
Exocyst complex component 8 (EXOC8) Bovine ELISA Kit
D2931 96 Tests

Exocyst complex component 8 (EXOC8) Bovine ELISA Kit

Ask
View Details
FHL1 (Four And A Half LIM Domains Protein 1, FHL-1, Skeletal Muscle LIM-protein 1, SLIM 1, SLIM, SLIM1) (MaxLight 750) discontinued
126808-ML750 100 µL

FHL1 (Four And A Half LIM Domains Protein 1, FHL-1, Skeletal Muscle LIM-protein 1, SLIM 1, SLIM, SLIM1) (MaxLight 750) discontinued

Ask
View Details
HASPIN Knockout Jurkat Polyclonal Cells
ARG23365 1 Million

HASPIN Knockout Jurkat Polyclonal Cells

Ask
View Details