Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Scaffold protein ILK (ILK)

Product Specifications

Product Name Alternative

59KDA serine/threonine-protein kinaseILK-1ILK-2p59ILK

Abbreviation

Recombinant Human ILK protein

Gene Name

ILK

UniProt

Q13418

Expression Region

1-452aa

Organism

Homo sapiens (Human)

Target Sequence

MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.3 kDa

References & Citations

Regulation of cell adhesion and anchorage-dependent growth by a new beta 1-integrin-linked protein kinase.Hannigan G.E., Leung-Hagesteijn C., Fitz-Gibbon L., Coppolino M.G., Radeva G., Filmus J., Bell J.C., Dedhar S.Nature 379:91-96 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) ELISA Kit
MBS7246982-01 48 Well

Rabbit CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) ELISA Kit

Ask
View Details
Rabbit CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) ELISA Kit
MBS7246982-02 96 Well

Rabbit CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) ELISA Kit

Ask
View Details
Rabbit CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) ELISA Kit
MBS7246982-03 5x 96 Well

Rabbit CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) ELISA Kit

Ask
View Details
Rabbit CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) ELISA Kit
MBS7246982-04 10x 96 Well

Rabbit CDK5 regulatory subunit-associated protein 1-like 1 (CDKAL1) ELISA Kit

Ask
View Details
Transcription Factor E3 (TFE3, Transcription Factor Binding to IGHM Enhancer 3, Class E Basic Helix-loop-helix Protein 33, bHLHe33, RCCP2, TFEA) (MaxLight 550)
MBS6397090-01 0.1 mL

Transcription Factor E3 (TFE3, Transcription Factor Binding to IGHM Enhancer 3, Class E Basic Helix-loop-helix Protein 33, bHLHe33, RCCP2, TFEA) (MaxLight 550)

Ask
View Details
Transcription Factor E3 (TFE3, Transcription Factor Binding to IGHM Enhancer 3, Class E Basic Helix-loop-helix Protein 33, bHLHe33, RCCP2, TFEA) (MaxLight 550)
MBS6397090-02 5x 0.1 mL

Transcription Factor E3 (TFE3, Transcription Factor Binding to IGHM Enhancer 3, Class E Basic Helix-loop-helix Protein 33, bHLHe33, RCCP2, TFEA) (MaxLight 550)

Ask
View Details