Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2-T23 Mouse Gene Knockout Kit (CRISPR)
KN507518 1 Kit

H2-T23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rabbit CCN2 Matched Antibody Pair Set [ABP-S-051638]
ABP-S-051638 5 Plates

Rabbit CCN2 Matched Antibody Pair Set [ABP-S-051638]

Sign In for Pricing
View Details
Mouse Monoclonal Adenylate Cyclase 8 Antibody (ADCY8/7341) [DyLight 650]
NBP3-24064C 0.1 mL

Mouse Monoclonal Adenylate Cyclase 8 Antibody (ADCY8/7341) [DyLight 650]

Sign In for Pricing
View Details
V1rf4 Protein Vector (Rat) (pPB-C-His)
PV314982 500 ng

V1rf4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal THUMPD2 Antibody
NBP2-93708-0.1mL 0.1 mL

Rabbit Polyclonal THUMPD2 Antibody

Sign In for Pricing
View Details
GS-9901
MF-0032944-01 1 mg

GS-9901

Sign In for Pricing
View Details