MICA, Human (HEK293, His)
MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MICA Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html
Purity
95.0
Smiles
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Molecular Formula
100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6389266-01 0.1 mL
PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) (HRP)
Sign In for Pricing
View Details 
MBS6389266-02 5x 0.1 mL
PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) (HRP)
Sign In for Pricing
View Details 
034441-HRP 200 µL
CYP4V2, CT (CYP4V2, Cytochrome P450 4V2) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 
GTR15211465 1 Vial
Lentiviral mouse Pin1rt1 shRNA (UAS) - Lentiviral mouse Pin1rt1 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details