Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Androgen Receptor Antibody
RC-17015-01 50 μL

Recombinant Androgen Receptor Antibody

Sign In for Pricing
View Details
Recombinant Androgen Receptor Antibody
RC-17015-02 100 µL

Recombinant Androgen Receptor Antibody

Sign In for Pricing
View Details
Recombinant Androgen Receptor Antibody
RC-17015-03 1 mL

Recombinant Androgen Receptor Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal FIGNL1 Antibody [Alexa Fluor 532]
NB100-2355AF532 0.1 mL

Rabbit Polyclonal FIGNL1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
valyl tRNA synthetase (VARS) (NM_006295) Human Over-expression Lysate
LY416738 100 µg

valyl tRNA synthetase (VARS) (NM_006295) Human Over-expression Lysate

Sign In for Pricing
View Details
Fast Green FCF Stain Solution, 0.1%
G1660 100 mL

Fast Green FCF Stain Solution, 0.1%

Sign In for Pricing
View Details