Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PLA2R1 Antibody (12-6-5) [Alexa Fluor 750]
NBP2-50248AF750 0.1 mL

Mouse Monoclonal PLA2R1 Antibody (12-6-5) [Alexa Fluor 750]

Sign In for Pricing
View Details
Scrn2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6429002 1.0 µg DNA

Scrn2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal TGF-beta 1 Antibody (OTI1E12) [CoraFluor 1]
NBP2-74495CL1 0.1 mL

Mouse Monoclonal TGF-beta 1 Antibody (OTI1E12) [CoraFluor 1]

Sign In for Pricing
View Details
TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (MaxLight 490)
252745-ML490 100 µL

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (MaxLight 490)

Sign In for Pricing
View Details
GAPDHP23 3'UTR Luciferase Stable Cell Line
TU008578 1.0 mL

GAPDHP23 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal SLC36A1 Antibody
NBP1-81280 0.1 mL

Rabbit Polyclonal SLC36A1 Antibody

Sign In for Pricing
View Details