Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tspan11 (NM_026743) Mouse Tagged Lenti ORF Clone
MR203244L3 10 µg

Tspan11 (NM_026743) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IL8 Protein (C-6xHis Tag, )
P511664 100 µg

IL8 Protein (C-6xHis Tag, )

Sign In for Pricing
View Details
GLUT1, CT (Solute Carrier Family 2, Facilitated Glucose Transporter Member 1, Glucose Transporter Type 1, Erythrocyte/Brain, GLUT-1, HepG2 Glucose Transporter, SLC2A1) discontinued
G3900-01T 250 µL

GLUT1, CT (Solute Carrier Family 2, Facilitated Glucose Transporter Member 1, Glucose Transporter Type 1, Erythrocyte/Brain, GLUT-1, HepG2 Glucose Transporter, SLC2A1) discontinued

Sign In for Pricing
View Details
Mouse Rbm39 activation kit by CRISPRa
GA212617 1 Kit

Mouse Rbm39 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Paraneoplastic antigen Ma1 homolog (PNMA1) ELISA Kit
abx382324 96 Tests

Human Paraneoplastic antigen Ma1 homolog (PNMA1) ELISA Kit

Sign In for Pricing
View Details
SLC15A3 Protein Vector (Rat) (pPB-C-His)
PV305278 500 ng

SLC15A3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details