MICA, Human (HEK293, His)
MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MICA Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html
Purity
95.0
Smiles
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Molecular Formula
100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9345056 Inquire
Fish Integral Membrane Protein GPR137B (GPR137B) ELISA Kit
Sign In for Pricing
View Details 
LV679416 1.0 µg DNA
HNRNPC Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
K3790206 1.0 µg DNA
Hspb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
MBS7241754-01 48 Well
Canine Alpha-2-macroglobulin-like protein 1 (A2ML1) ELISA Kit
Sign In for Pricing
View Details