Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADB-4-Hydroxy-BUTINACA
TRC-C667720-250MG 250 mg

ADB-4-Hydroxy-BUTINACA

Sign In for Pricing
View Details
C7orf50 (NM_001134395) Human Mass Spec Standard
PH325215 10 µg

C7orf50 (NM_001134395) Human Mass Spec Standard

Sign In for Pricing
View Details
Human Mercaptopyruvate Sulfurtransferase (MPST) ELISA kit
YLA3006HU-01 48 Tests

Human Mercaptopyruvate Sulfurtransferase (MPST) ELISA kit

Sign In for Pricing
View Details
Human Mercaptopyruvate Sulfurtransferase (MPST) ELISA kit
YLA3006HU-02 96 Tests

Human Mercaptopyruvate Sulfurtransferase (MPST) ELISA kit

Sign In for Pricing
View Details
SNS-032 (CDK inhibitor)
SC6641-25mg 25 mg

SNS-032 (CDK inhibitor)

Sign In for Pricing
View Details
PDLIM2 Human qPCR Primer Pair (NM_021630)
HP214190 200 Reactions

PDLIM2 Human qPCR Primer Pair (NM_021630)

Sign In for Pricing
View Details