Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory receptor 51I2 Polyclonal Antibody
RA28153-01 50 µL

Olfactory receptor 51I2 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 51I2 Polyclonal Antibody
RA28153-02 100 µL

Olfactory receptor 51I2 Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein S6 (phospho Ser240) Rabbit Polyclonal Antibody
E28PP0893 100 µL

Ribosomal Protein S6 (phospho Ser240) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-formylpyridine-2-carboxylic acid
JH329317 1 Each

5-formylpyridine-2-carboxylic acid

Sign In for Pricing
View Details
AWAT2 Antibody
MBS8518160-01 0.05 mg

AWAT2 Antibody

Sign In for Pricing
View Details
AWAT2 Antibody
MBS8518160-02 0.1 mg

AWAT2 Antibody

Sign In for Pricing
View Details