Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF beta antibody (allophycocyanin)
MBS834341-01 0.05 mg

TNF beta antibody (allophycocyanin)

Sign In for Pricing
View Details
TNF beta antibody (allophycocyanin)
MBS834341-02 5x 0.05 mg

TNF beta antibody (allophycocyanin)

Sign In for Pricing
View Details
Lentiviral mouse Dusp14 shRNA (UAS) - Lentiviral mouse Dusp14 shRNA (UAS, RFP) (100)
GTR15237120 1 Vial

Lentiviral mouse Dusp14 shRNA (UAS) - Lentiviral mouse Dusp14 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
DCTN6 CytoSection
TS401937P5 25 Slides

DCTN6 CytoSection

Sign In for Pricing
View Details
Mouse Rab11fip1 activation kit by CRISPRa
GA210341 1 Kit

Mouse Rab11fip1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mcf2l (NM_053951) Rat Untagged Clone
RN208691 10 µg

Mcf2l (NM_053951) Rat Untagged Clone

Sign In for Pricing
View Details