Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10H5 Peptide - C-terminal region
MBS3243708-01 0.1 mg

OR10H5 Peptide - C-terminal region

Sign In for Pricing
View Details
OR10H5 Peptide - C-terminal region
MBS3243708-02 5x 0.1 mg

OR10H5 Peptide - C-terminal region

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)
MBS2167445-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)
MBS2167445-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)
MBS2167445-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)
MBS2167445-04 1 mL

Biotin-Linked Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)

Sign In for Pricing
View Details