Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTF4 polyclonal antibody
BS6135-01 50 µL

NTF4 polyclonal antibody

Sign In for Pricing
View Details
NTF4 polyclonal antibody
BS6135-02 100 µL

NTF4 polyclonal antibody

Sign In for Pricing
View Details
Cd63 (BC089543) Mouse Tagged ORF Clone
MG202911 10 µg

Cd63 (BC089543) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tmem230 (NM_001048043) Rat Untagged Clone
RN206160 10 µg

Tmem230 (NM_001048043) Rat Untagged Clone

Sign In for Pricing
View Details
Rat Mag Pre-designed siRNA Set B
SI208005B 1 Each

Rat Mag Pre-designed siRNA Set B

Sign In for Pricing
View Details
CSPS (SULT1A3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E1]
TA811110AM 100 µL

CSPS (SULT1A3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E1]

Sign In for Pricing
View Details