MICA, Human (HEK293, His)
MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MICA Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html
Purity
95.0
Smiles
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Molecular Formula
100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS620426-01 0.1 mg
CPT1A (Cpt1a, carnitine palmitoyltransferase 1A, liver, CPT1, CPT1-L, L-CPT1, C730027G07, carnitine palmitoyltransferase 1A, carnitine palmitoyltransferase 1, liver)
Sign In for Pricing
View Details 
MBS620426-02 5x 0.1 mg
CPT1A (Cpt1a, carnitine palmitoyltransferase 1A, liver, CPT1, CPT1-L, L-CPT1, C730027G07, carnitine palmitoyltransferase 1A, carnitine palmitoyltransferase 1, liver)
Sign In for Pricing
View Details 
129186-ML490 100 µL
LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 490)
Sign In for Pricing
View Details bsm-61984R-PerCP-Cy5.5 100 µL
CYP1B1 Recombinant Antibody, PerCP-Cy5.5 Conjugated
Sign In for Pricing
View Details