MICA, Human (HEK293, His)
MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MICA Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html
Purity
95.0
Smiles
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Molecular Formula
100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
366796 1 Kit
Genesig Pollock Fish Speciation Kit, Standard discontinued
Sign In for Pricing
View Details 
bs-9095R-BF680 100 µL
AGXT2L2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
Sign In for Pricing
View Details K6652202 1.0 µg DNA
LOC361914 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
MBS7024904-01 0.02 mg
Recombinant Human Olfactory receptor 4F5 (OR4F5)
Sign In for Pricing
View Details 
MBS7024904-02 0.1 mg
Recombinant Human Olfactory receptor 4F5 (OR4F5)
Sign In for Pricing
View Details