MICA, Human (HEK293, His)
MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MICA Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html
Purity
95.0
Smiles
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Molecular Formula
100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
133637-ML650 100 µL
SNRPB (Small Nuclear Ribonucleoprotein-associated Proteins B and B', snRNP-B, Sm Protein B/B', Sm-B/Sm-B', SmB/SmB', SNRPB1, COD) (MaxLight 650)
Sign In for Pricing
View Details 
367078-01 25 Tests
CD33 (Myeloid Cell Surface Antigen CD33 Precursor, Sialic Acid Binding Immunoglobulin Like Lectin 3, Siglec 3, Siglec 3, p67) (PE)
Sign In for Pricing
View Details 367078-02 100 Tests
CD33 (Myeloid Cell Surface Antigen CD33 Precursor, Sialic Acid Binding Immunoglobulin Like Lectin 3, Siglec 3, Siglec 3, p67) (PE)
Sign In for Pricing
View Details 
367078-03 200 Tests
CD33 (Myeloid Cell Surface Antigen CD33 Precursor, Sialic Acid Binding Immunoglobulin Like Lectin 3, Siglec 3, Siglec 3, p67) (PE)
Sign In for Pricing
View Details