MICA, Human (HEK293, His)
MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MICA Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html
Purity
95.0
Smiles
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Molecular Formula
100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal ORC1 Antibody (7F6/1) [Alexa Fluor 700]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP3-08793AF700 100 µL
Mouse Monoclonal ORC1 Antibody (7F6/1) [Alexa Fluor 700]
Sign In for Pricing
View Details 
MBS7144182 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) MGP Polyclonal Antibody
Sign In for Pricing
View Details 
MBS2053948-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)
Sign In for Pricing
View Details MBS2053948-02 0.2 mL
Cy3-Linked Polyclonal Antibody to Growth Associated Protein 43 (GAP43)
Sign In for Pricing
View Details