Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mup19 sgRNA CRISPR Lentivector set (Mouse)
K3301901 3x 1.0 µg

Mup19 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
ML-18 25mg
A20057-25 25 mg

ML-18 25mg

Sign In for Pricing
View Details
Mouse Col24a1 Pre-designed siRNA Set A
SI102884A 1 Each

Mouse Col24a1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ZNF784 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2733208 1.0 µg DNA

ZNF784 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal Rictor Antibody [Alexa Fluor 405]
NB100-611AF405 100 µL

Rabbit Polyclonal Rictor Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
ARHGAP23 sgRNA CRISPR Lentivector set (Human)
K0116301 3x 1.0 µg

ARHGAP23 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details