Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICA, Human (HEK293, His)

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MICA Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html

Purity

95.0

Smiles

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Formula

100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)

Molecular Weight

Approximately 60.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL54 CytoSection
TS408976P5 25 Slides

MRPL54 CytoSection

Sign In for Pricing
View Details
Bovine Vitamin A (VA) ELISA Kit
SL0081Bo-01 48 Tests

Bovine Vitamin A (VA) ELISA Kit

Sign In for Pricing
View Details
Bovine Vitamin A (VA) ELISA Kit
SL0081Bo-02 96 Tests

Bovine Vitamin A (VA) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human CCNYL1 sgRNA gene knockout kit - Lentiviral human CCNYL1 sgRNA gene knockout kit (plasmid)
GTR15400865 1 Vial

Lentiviral human CCNYL1 sgRNA gene knockout kit - Lentiviral human CCNYL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
N-(1,3,4-Thiadiazolyl)nicotinamide
TRC-T344000-1G 1 g

N-(1,3,4-Thiadiazolyl)nicotinamide

Sign In for Pricing
View Details
Transmembrane protein 198 (TMEM198) Bovine ELISA Kit
H8400 96 Tests

Transmembrane protein 198 (TMEM198) Bovine ELISA Kit

Sign In for Pricing
View Details