MICA, Human (HEK293, His)
MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MICA Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mica-protein-human-hek-293-his.html
Purity
95.0
Smiles
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Molecular Formula
100507436 (Gene_ID) AAH16929.1 (E24-Q308) (Accession)
Molecular Weight
Approximately 60.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6249703-01 0.1 mL
CD62p (LECAM, P-Selectin, Endothelial Leukocyte Adhesion Molecule) (FITC)
Sign In for Pricing
View Details MBS6249703-02 5x 0.1 mL
CD62p (LECAM, P-Selectin, Endothelial Leukocyte Adhesion Molecule) (FITC)
Sign In for Pricing
View Details 132037-PE 100 µL
PTHLH (Parathyroid Hormone-related Protein, PTH-rP, PTHrP, Parathyroid Hormone-like Protein, PTHrP[1-36], PTHrP[38-94], Osteostatin, PTHrP[107-139], PTHRP, MGC14611) (PE)
Sign In for Pricing
View Details ![Recombinant Saccharomyces Cerevisiae SPC29 Protein (aa 1-253) [His] (strain Lalvin QA23)](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
VAng-Wyb5868-1mg 1 mg
Recombinant Saccharomyces Cerevisiae SPC29 Protein (aa 1-253) [His] (strain Lalvin QA23)
Sign In for Pricing
View Details