Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2G2, Human (GST)

The UBE2G2 protein is an important ubiquitination component that accepts ubiquitin in the E1 complex, catalyzes its covalent attachment to various proteins, and preferentially performs "Lys-48"-linked polyubiquitination. Its specificity in shaping ubiquitin chains emphasizes its role in cellular processes. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UBE2G2 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2g2-protein-human-gst.html

Purity

97.50

Smiles

MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

Molecular Formula

7327 (Gene_ID) P60604 (M1-L165) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3-kinase p110 subunit beta Recombinant Rabbit Monoclonal Antibody [SC0580]
ET1610-36 100 µL

PI3-kinase p110 subunit beta Recombinant Rabbit Monoclonal Antibody [SC0580]

Sign In for Pricing
View Details
(S)-tert-Butyl 3-Aminopiperidine-1-carboxylate
TRC-S960110-10MG 10 mg

(S)-tert-Butyl 3-Aminopiperidine-1-carboxylate

Sign In for Pricing
View Details
CREM (NM_001267565) Human Tagged ORF Clone
RG235903 10 µg

CREM (NM_001267565) Human Tagged ORF Clone

Sign In for Pricing
View Details
3,13-Dihydroxy-13,17-secoandrost-5-en-17-oic Acid Delta-Lactone
TRC-D454880-5MG 5 mg

3,13-Dihydroxy-13,17-secoandrost-5-en-17-oic Acid Delta-Lactone

Sign In for Pricing
View Details
Human ZNF707 activation kit by CRISPRa
GA117273 1 Kit

Human ZNF707 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TEKT2 activation kit by CRISPRa
GA109095 1 Kit

Human TEKT2 activation kit by CRISPRa

Sign In for Pricing
View Details