Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-22, Mouse (His)

IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (His) is the recombinant mouse-derived IL-22 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-22 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-22-protein-mouse-his.html

Purity

95.0

Smiles

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Molecular Formula

50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Saxton RA, et al. The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design. Immunity. 2021 Apr 13;54 (4) :660-672.e9.|[2]Delbue D, et al. Reprogramming Intestinal Epithelial Cell Polarity by Interleukin-22. Front Med (Lausanne) . 2021 Apr 12;8:656047.|[3]Weathington NM, et al. Glycogen synthase kinase-3β stabilizes the interleukin (IL) -22 receptor from proteasomal degradation in murine lung epithelia. J Biol Chem. 2014 Jun 20;289 (25) :17610-9.|[4]Wei CC, et al. Cloning and characterization of mouse IL-22 binding protein. Genes Immun. 2003 Apr;4 (3) :204-11.|[5]Dudakov JA, et al. Interleukin-22: immunobiology and pathology. Annu Rev Immunol. 2015;33:747-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCDC5 (C-term) Rabbit Polyclonal Antibody
AP51197PU-N 400 µL

DCDC5 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CtBP1 Polyclonal Antibody
E-AB-90907-01 60 µL

CtBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CtBP1 Polyclonal Antibody
E-AB-90907-02 120 µL

CtBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CtBP1 Polyclonal Antibody
E-AB-90907-03 200 µL

CtBP1 Polyclonal Antibody

Sign In for Pricing
View Details
FXYD3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]
TA504572AM 100 µL

FXYD3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
POLDIP1 (KCTD13) Mouse Monoclonal Antibody [Clone ID: OTI3B12]
CF808801 100 µg

POLDIP1 (KCTD13) Mouse Monoclonal Antibody [Clone ID: OTI3B12]

Sign In for Pricing
View Details