Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome P450 2C19 (CYP2C19)

Product Specifications

Product Name Alternative

(R) -limonene 6-monooxygenase ((S) -limonene 6-monooxygenase) ((S) -limonene 7-monooxygenase) (CYPIIC17) (CYPIIC19) (Cytochrome P450-11A) (Cytochrome P450-254C) (Fenbendazole monooxygenase) (Mephenytoin 4-hydroxylase)

Abbreviation

Recombinant Human CYP2C19 protein

Gene Name

CYP2C19

UniProt

P33261

Expression Region

26-490aa

Organism

Homo sapiens (Human)

Target Sequence

RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Responsible for the metabolism of a number of therapeutic agents such as the anticonvulsant drug S-mephenytoin, omeprazole, proguanil, certain barbiturates, diazepam, propranolol, citalopram and imipramine. Oxygenates (R) - and (S) -limonene to produce carveol and perillyl alcohol. Hydroxylates fenbendazole at the 4' position.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

60.6 kDa

References & Citations

"Isolation and characterization of human liver cytochrome P450 2C19: correlation between 2C19 and S-mephenytoin 4'-hydroxylation." Wrighton S.A., Stevens J.C., Becker G.W., VandenBranden M. Arch. Biochem. Biophys. 306:240-245 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rdh19 Mouse Gene Knockout Kit (CRISPR)
KN514630 1 Kit

Rdh19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB11A Rabbit Polyclonal Antibody
TA380603 100 µL

RAB11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse ICOS/AILIM Protein (Fc Tag)
PKSM040666-01 100 µg

Recombinant Mouse ICOS/AILIM Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse ICOS/AILIM Protein (Fc Tag)
PKSM040666-02 1 mg

Recombinant Mouse ICOS/AILIM Protein (Fc Tag)

Sign In for Pricing
View Details
Agarose LE, Ultra-Pure Molecular Biology Grade, 500 g
#41028-500G 1x 500 g

Agarose LE, Ultra-Pure Molecular Biology Grade, 500 g

Sign In for Pricing
View Details
Texas Red Conjugated Morniga M Lectin (black mulberry) -MNA-M-
T-9004-1 1 mg

Texas Red Conjugated Morniga M Lectin (black mulberry) -MNA-M-

Sign In for Pricing
View Details