Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Mouse (HEK293, His)

TIMP-2 is a tissue inhibitor of metalloproteinases that forms complexes with metalloproteinases, especially collagenases, effectively and irreversibly inactivating them by binding to their catalytic zinc cofactor.This interaction plays a crucial role in regulating the activity of metalloproteinases.TIMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-mouse-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

21858 (Gene_ID) P25785 (C27-P220) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone
276401-01 1 mg

4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone

Sign In for Pricing
View Details
4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone
276401-02 2 mg

4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone

Sign In for Pricing
View Details
4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone
276401-03 5 mg

4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone

Sign In for Pricing
View Details
4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone
276401-04 10 mg

4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone

Sign In for Pricing
View Details
4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone
276401-05 25 mg

4-[ (4-Fluorophenyl) methylene]-2-methyl-5 (4H) -oxazolone

Sign In for Pricing
View Details
7-Bromo-1-methyl-1H,2H,3H-pyrazolo[1,5-a]imidazole
TEA76786-01 50 mg

7-Bromo-1-methyl-1H,2H,3H-pyrazolo[1,5-a]imidazole

Sign In for Pricing
View Details