Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free HMGB1/HMG-1, Mouse (His)

HMGB1, or high mobility group box 1, is a protein that plays a role in various cellular processes. It has different functionalities depending on its redox state and location within the cell. Animal-Free HMGB1/HMG-1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeHMGB1/HMG-1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free HMGB1/HMG-1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-hmgb1-hmg-1-protein-mouse-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Molecular Formula

15289 (Gene_ID) P63158 (M1-E215) (Accession)

Molecular Weight

Approximately 25.56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX2 Rabbit Polyclonal Antibody
TA381517 100 µL

SIX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FABP12 Human Gene Knockout Kit (CRISPR)
KN425117 1 Kit

FABP12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MMP13 Recombinant Rabbit monoclonal Antibody
HA723294 100 µL

Human MMP13 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
RMND5A Antibody
KC-2734-01 50 μL

RMND5A Antibody

Sign In for Pricing
View Details
RMND5A Antibody
KC-2734-02 100 µL

RMND5A Antibody

Sign In for Pricing
View Details
RMND5A Antibody
KC-2734-03 1 mL

RMND5A Antibody

Sign In for Pricing
View Details