Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD43, Mouse (HEK293, Fc)

CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD43 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd43-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSG

Molecular Formula

20737 (Gene_ID) P15702 (D20-G248) (Accession)

Molecular Weight

72-120 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AOX1 | Algal Alternative oxidase 1
AS06 152 50 µL

Anti-AOX1 | Algal Alternative oxidase 1

Sign In for Pricing
View Details
UBE2T discontinued
395863 200 µL

UBE2T discontinued

Sign In for Pricing
View Details
SRSF10 Protein Vector (Rat) (pPM-C-His)
PV308141 500 ng

SRSF10 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Rat Nicotinamide Phosphoribosyltransferase (NAMPT) CLIA Kit
abx491812-01 96 Tests

Rat Nicotinamide Phosphoribosyltransferase (NAMPT) CLIA Kit

Sign In for Pricing
View Details
Rat Nicotinamide Phosphoribosyltransferase (NAMPT) CLIA Kit
abx491812-02 5x 96 Tests

Rat Nicotinamide Phosphoribosyltransferase (NAMPT) CLIA Kit

Sign In for Pricing
View Details
Rat Nicotinamide Phosphoribosyltransferase (NAMPT) CLIA Kit
abx491812-03 10x 96 Tests

Rat Nicotinamide Phosphoribosyltransferase (NAMPT) CLIA Kit

Sign In for Pricing
View Details