Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP5, Human (His)

FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human (His) is the recombinant human-derived FABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp5-protein-human-his.html

Purity

95.00

Smiles

ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Molecular Formula

2171 (Gene_ID) Q01469 (A2-E135) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EME1 Rabbit Polyclonal Antibody
TA375881 100 µL

EME1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thioflavin T
23060-AAT 1 g

Thioflavin T

Sign In for Pricing
View Details
Cytokeratin 19 Recombinant Rabbit monoclonal Antibody [SA30-06]
ET1601-6-50UL 50 µL

Cytokeratin 19 Recombinant Rabbit monoclonal Antibody [SA30-06]

Sign In for Pricing
View Details
Recombinant RPS20 Monoclonal Antibody
E-AB-81509-01 50 µL

Recombinant RPS20 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant RPS20 Monoclonal Antibody
E-AB-81509-02 100 µL

Recombinant RPS20 Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS505262 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details