Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP5, Human (His)

FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human (His) is the recombinant human-derived FABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp5-protein-human-his.html

Purity

95.00

Smiles

ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Molecular Formula

2171 (Gene_ID) Q01469 (A2-E135) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEDD1 Rabbit Polyclonal Antibody
TA396586S 25 µL

NEDD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP1A3 Human qPCR Primer Pair (NM_152296)
HP226352 200 Reactions

ATP1A3 Human qPCR Primer Pair (NM_152296)

Sign In for Pricing
View Details
TAZ Mouse Monoclonal Antibody [Clone ID: N173B/13]
75-197 100 µL

TAZ Mouse Monoclonal Antibody [Clone ID: N173B/13]

Sign In for Pricing
View Details
Human ARMETL1 (CDNF) activation kit by CRISPRa
GA118520 1 Kit

Human ARMETL1 (CDNF) activation kit by CRISPRa

Sign In for Pricing
View Details
Silymarin (>80%)
TRC-S465895-5G 5 g

Silymarin (>80%)

Sign In for Pricing
View Details
ZBTB10 (NM_001105539) Human Over-expression Lysate
LC426258 20 µg

ZBTB10 (NM_001105539) Human Over-expression Lysate

Sign In for Pricing
View Details