Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP5, Human (His)

FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human (His) is the recombinant human-derived FABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp5-protein-human-his.html

Purity

95.00

Smiles

ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Molecular Formula

2171 (Gene_ID) Q01469 (A2-E135) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmoglein 3 (DSG3) (N-term) Rabbit Polyclonal Antibody
AP51324PU-N 400 µL

Desmoglein 3 (DSG3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syndecan 4 (SDC4) (NM_002999) Human Over-expression Lysate
LY401051 100 µg

Syndecan 4 (SDC4) (NM_002999) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Lunatic Fringe Antibody
RC-16588-01 50 μL

Recombinant Lunatic Fringe Antibody

Sign In for Pricing
View Details
Recombinant Lunatic Fringe Antibody
RC-16588-02 100 µL

Recombinant Lunatic Fringe Antibody

Sign In for Pricing
View Details
Recombinant Lunatic Fringe Antibody
RC-16588-03 1 mL

Recombinant Lunatic Fringe Antibody

Sign In for Pricing
View Details
Transmembrane Protein 175 (TMEM175) (NM_001297427) Human Tagged ORF Clone
RG237907 10 µg

Transmembrane Protein 175 (TMEM175) (NM_001297427) Human Tagged ORF Clone

Sign In for Pricing
View Details