Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP5, Human (His)

FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human (His) is the recombinant human-derived FABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp5-protein-human-his.html

Purity

95.00

Smiles

ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Molecular Formula

2171 (Gene_ID) Q01469 (A2-E135) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR70 Antibody
KC-36521-01 50 μL

WDR70 Antibody

Sign In for Pricing
View Details
WDR70 Antibody
KC-36521-02 100 µL

WDR70 Antibody

Sign In for Pricing
View Details
WDR70 Antibody
KC-36521-03 1 mL

WDR70 Antibody

Sign In for Pricing
View Details
PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI3D7]
CF805647 100 µg

PAGE1 Mouse Monoclonal Antibody [Clone ID: OTI3D7]

Sign In for Pricing
View Details
Human PCDHA6 activation kit by CRISPRa
GA111134 1 Kit

Human PCDHA6 activation kit by CRISPRa

Sign In for Pricing
View Details
RNF169 Human Gene Knockout Kit (CRISPR)
KN416450 1 Kit

RNF169 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details