Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHA, Rat (His)

The LDHA protein facilitates the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the concomitant exchange of NADH and NAD (+) .LDHA Protein, Rat (His) is the recombinant rat-derived LDHA protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

LDHA Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ldha-protein-rat-his.html

Purity

98.0

Smiles

MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF

Molecular Formula

24533 (Gene_ID) P04642 (M1-F332) (Accession)

Molecular Weight

Approximately 38.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-22, C-His, Flag Tag
HA210691-01 20 µg

Human IL-22, C-His, Flag Tag

Sign In for Pricing
View Details
Human IL-22, C-His, Flag Tag
HA210691-02 50 µg

Human IL-22, C-His, Flag Tag

Sign In for Pricing
View Details
Human IL-22, C-His, Flag Tag
HA210691-03 100 µg

Human IL-22, C-His, Flag Tag

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), Biotin conjugate, 0.1mg/mL
BNCB1497-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGD (NM_002631) Human Over-expression Lysate
LC419202 20 µg

PGD (NM_002631) Human Over-expression Lysate

Sign In for Pricing
View Details
CMC4 Human Gene Knockout Kit (CRISPR)
KN400618 1 Kit

CMC4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details